Anti-ITIH4

Artikelnummer: ATA-AMAB90921
Artikelname: Anti-ITIH4
Artikelnummer: ATA-AMAB90921
Hersteller Artikelnummer: AMAb90921
Alternativnummer: ATA-AMAB90921-100,ATA-AMAB90921-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: H4P, IHRP, ITIHL1
inter-alpha-trypsin inhibitor heavy chain family, member 4
Anti-ITIH4
Klonalität: Monoclonal
Konzentration: 0.1
Klon-Bezeichnung: [CL1858]
Isotyp: IgG1
NCBI: 3700
UniProt: Q14624
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITIH4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human liver shows immunoreactivity in sinusoids.
Immunohistochemical staining of human fallopian tube shows strong immunoreactivity in blood vessels and in plasma.
Immunohistochemical staining of human kidney (renal cancer) shows strong positivity in plasma in blood vessels.
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human liver tissue lysate
AMAb90921-100ul
AMAb90921-100ul
AMAb90921-100ul