Anti-ITIH4

Catalog Number: ATA-AMAB90921
Article Name: Anti-ITIH4
Biozol Catalog Number: ATA-AMAB90921
Supplier Catalog Number: AMAb90921
Alternative Catalog Number: ATA-AMAB90921-100,ATA-AMAB90921-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: H4P, IHRP, ITIHL1
inter-alpha-trypsin inhibitor heavy chain family, member 4
Anti-ITIH4
Clonality: Monoclonal
Concentration: 0.1
Clone Designation: [CL1858]
Isotype: IgG1
NCBI: 3700
UniProt: Q14624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ITIH4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human liver shows immunoreactivity in sinusoids.
Immunohistochemical staining of human fallopian tube shows strong immunoreactivity in blood vessels and in plasma.
Immunohistochemical staining of human kidney (renal cancer) shows strong positivity in plasma in blood vessels.
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human liver tissue lysate
AMAb90921-100ul
AMAb90921-100ul
AMAb90921-100ul