Anti-ITIH4 Antibody , IgG1, Clone: [CL1858], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-ITIH4 Antibody , IgG1, Clone: [CL1858], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90921
• Supplier Catalog Number: AMAb90921
• Alternative Catalog Number: ATA-AMAB90921-100,ATA-AMAB90921-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: H4P, IHRP, ITIHL1

Product Description

inter-alpha-trypsin inhibitor heavy chain family, member 4

Additional Information

Anti-ITIH4

Product Properties

• Clonality: Monoclonal
• Concentration: 0.1
• Clone Designation: [CL1858]
• Isotype: IgG1
• NCBI: 3700
• UniProt: Q14624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ITIH4
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:2500 - 1:5000, WB: 1 µg/ml

Images

Immunohistochemical staining of human liver shows immunoreactivity in sinusoids.

Immunohistochemical staining of human fallopian tube shows strong immunoreactivity in blood vessels and in plasma.

Immunohistochemical staining of human kidney (renal cancer) shows strong positivity in plasma in blood vessels.

Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).

Lane 1: Marker [kDa]
Lane 2: Human liver tissue lysate

AMAb90921

AMAb90921

AMAb90921