Anti-ENG Antibody , IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90925
| Artikelname: |
Anti-ENG Antibody , IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal |
| Artikelnummer: |
ATA-AMAB90925 |
| Hersteller Artikelnummer: |
AMAb90925 |
| Alternativnummer: |
ATA-AMAB90925-100,ATA-AMAB90925-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CD105, END, HHT1, ORW, ORW1 |
| Klonalität: |
Monoclonal |
| Konzentration: |
0.1 |
| Klon-Bezeichnung: |
[CL1912] |
| Isotyp: |
IgG1 |
| NCBI: |
2022 |
| UniProt: |
P17813 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Protein A purified |
| Sequenz: |
ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
ENG |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:500 - 1:1000 |
|
Immunohistochemical staining of human renal cancer shows strong immunoreactivity in the blood vessels. |
|
Immunohistochemical staining of human liver cancer shows positivity in the sinusoids. |
|
Immunohistochemical staining of human stomach cancer shows strong immunoreactivity in the blood vessels walls. |
|
Immunohistochemical staining of human colon shows moderate positivity in the endothelium of blood vessels. |
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the blood vessels. |
|
Immunohistochemical staining of smooth muscle shows absence of positivity in myocytes (negative control). |
|
AMAb90925 |
|
AMAb90925 |
|
AMAb90925 |