Anti-ENG Antibody , IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-ENG Antibody , IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90925
• Supplier Catalog Number: AMAb90925
• Alternative Catalog Number: ATA-AMAB90925-100,ATA-AMAB90925-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD105, END, HHT1, ORW, ORW1

Product Description

endoglin

Additional Information

Anti-ENG

Product Properties

• Clonality: Monoclonal
• Concentration: 0.1
• Clone Designation: [CL1912]
• Isotype: IgG1
• NCBI: 2022
• UniProt: P17813
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ENG
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemical staining of human renal cancer shows strong immunoreactivity in the blood vessels.

Immunohistochemical staining of human liver cancer shows positivity in the sinusoids.

Immunohistochemical staining of human stomach cancer shows strong immunoreactivity in the blood vessels walls.

Immunohistochemical staining of human colon shows moderate positivity in the endothelium of blood vessels.

Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the blood vessels.

Immunohistochemical staining of smooth muscle shows absence of positivity in myocytes (negative control).

AMAb90925

AMAb90925

AMAb90925