Anti-ENG Antibody , IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90925
Article Name: Anti-ENG Antibody , IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90925
Supplier Catalog Number: AMAb90925
Alternative Catalog Number: ATA-AMAB90925-100,ATA-AMAB90925-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD105, END, HHT1, ORW, ORW1
endoglin
Anti-ENG
Clonality: Monoclonal
Concentration: 0.1
Clone Designation: [CL1912]
Isotype: IgG1
NCBI: 2022
UniProt: P17813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ENG
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemical staining of human renal cancer shows strong immunoreactivity in the blood vessels.
Immunohistochemical staining of human liver cancer shows positivity in the sinusoids.
Immunohistochemical staining of human stomach cancer shows strong immunoreactivity in the blood vessels walls.
Immunohistochemical staining of human colon shows moderate positivity in the endothelium of blood vessels.
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the blood vessels.
Immunohistochemical staining of smooth muscle shows absence of positivity in myocytes (negative control).
AMAb90925
AMAb90925
AMAb90925