Anti-VGAT
Artikelnummer:
ATA-AMAB91043
- Bilder (8)
| Artikelname: | Anti-VGAT |
| Artikelnummer: | ATA-AMAB91043 |
| Hersteller Artikelnummer: | AMAb91043 |
| Alternativnummer: | ATA-AMAB91043-100,ATA-AMAB91043-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SLC32A1, bA122O1.1, VIAAT |
| solute carrier family 32 member 1 |
| Anti-VGAT |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL2793] |
| Isotyp: | IgG1 |
| NCBI: | 140679 |
| UniProt: | Q9H598 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC32A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunofluorescence staining of rat basal forebrain shows strong positivity in GABAergic fibers in the globus pallidus. |
|
|
Immunofluorescence staining of rat midbrain shows strong positivity in GABAergic fibers in substantia nigra, pars reticulata. |
|
|
Immunofluorescence staining of mouse basal forebrain shows positivity in GABAergic fibers in the globus pallidus. |
|
|
Immunofluorescence staining of mouse brain shows moderate positivity in GABAergic processes in the cerebellum. |
|
|
Immunohistochemical staining of human midbrain shows positivity in GABAergic fibers in substantia nigra, pars reticulata. |
|
|
AMAb91043-100ul |
|
|
AMAb91043-100ul |
|
|
AMAb91043-100ul |
Produktgarantie und fachkundiger Support
