Anti-VGAT
Catalog Number:
ATA-AMAB91043
- Images (8)
| Article Name: | Anti-VGAT |
| Biozol Catalog Number: | ATA-AMAB91043 |
| Supplier Catalog Number: | AMAb91043 |
| Alternative Catalog Number: | ATA-AMAB91043-100,ATA-AMAB91043-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SLC32A1, bA122O1.1, VIAAT |
| solute carrier family 32 member 1 |
| Anti-VGAT |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2793] |
| Isotype: | IgG1 |
| NCBI: | 140679 |
| UniProt: | Q9H598 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC32A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunofluorescence staining of rat basal forebrain shows strong positivity in GABAergic fibers in the globus pallidus. |
|
|
Immunofluorescence staining of rat midbrain shows strong positivity in GABAergic fibers in substantia nigra, pars reticulata. |
|
|
Immunofluorescence staining of mouse basal forebrain shows positivity in GABAergic fibers in the globus pallidus. |
|
|
Immunofluorescence staining of mouse brain shows moderate positivity in GABAergic processes in the cerebellum. |
|
|
Immunohistochemical staining of human midbrain shows positivity in GABAergic fibers in substantia nigra, pars reticulata. |
|
|
AMAb91043-100ul |
|
|
AMAb91043-100ul |
|
|
AMAb91043-100ul |
Product Guarantee and Expert Support
