Anti-LAMA1
Artikelnummer:
ATA-AMAB91091
- Bilder (8)
| Artikelname: | Anti-LAMA1 |
| Artikelnummer: | ATA-AMAB91091 |
| Hersteller Artikelnummer: | AMAb91091 |
| Alternativnummer: | ATA-AMAB91091-100,ATA-AMAB91091-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LAMA |
| laminin, alpha 1 |
| Anti-LAMA1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL2968] |
| Isotyp: | IgG1 |
| NCBI: | 284217 |
| UniProt: | P25391 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHATEFQRLADVLYSGLENIRNVSLNATSAA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LAMA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong immunoreactivity in basement membrane of seminiferous tubules. |
|
|
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control). |
|
|
Western blot analysis of purified human recombinant Laminin-111, Laminin-121, Laminin-221, Laminin-332, Laminin-411 and Laminin-521. |
|
|
Western blot analysis in human testis tissue. |
|
|
|
|
|
AMAb91091-100ul |
|
|
AMAb91091-100ul |
|
|
AMAb91091-100ul |
Produktgarantie und fachkundiger Support
