Anti-LAMA1
Catalog Number:
ATA-AMAB91091
- Images (8)
| Article Name: | Anti-LAMA1 |
| Biozol Catalog Number: | ATA-AMAB91091 |
| Supplier Catalog Number: | AMAb91091 |
| Alternative Catalog Number: | ATA-AMAB91091-100,ATA-AMAB91091-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LAMA |
| laminin, alpha 1 |
| Anti-LAMA1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2968] |
| Isotype: | IgG1 |
| NCBI: | 284217 |
| UniProt: | P25391 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHATEFQRLADVLYSGLENIRNVSLNATSAA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LAMA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong immunoreactivity in basement membrane of seminiferous tubules. |
|
|
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control). |
|
|
Western blot analysis of purified human recombinant Laminin-111, Laminin-121, Laminin-221, Laminin-332, Laminin-411 and Laminin-521. |
|
|
Western blot analysis in human testis tissue. |
|
|
|
|
|
AMAb91091-100ul |
|
|
AMAb91091-100ul |
|
|
AMAb91091-100ul |
Product Guarantee and Expert Support
