Anti-TPH2 Antibody , IgG1, Clone: [CL2990], Unconjugated, Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91108
| Artikelname: |
Anti-TPH2 Antibody , IgG1, Clone: [CL2990], Unconjugated, Mouse, Monoclonal |
| Artikelnummer: |
ATA-AMAB91108 |
| Hersteller Artikelnummer: |
AMAb91108 |
| Alternativnummer: |
ATA-AMAB91108-100,ATA-AMAB91108-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FLJ37295, NTPH |
| Klonalität: |
Monoclonal |
| Konzentration: |
1 |
| Klon-Bezeichnung: |
[CL2990] |
| Isotyp: |
IgG1 |
| NCBI: |
121278 |
| UniProt: |
Q8IWU9 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Protein A purified |
| Sequenz: |
SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
TPH2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:1000 - 1:2500 |
|
Immunofluorescence staining of rat midbrain shows strong positivity in serotonin neurons in the dorsal raphe nucleus. |
|
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the basal forebrain. |
|
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the cerebral cortex. |
|
Immunohistochemical staining of human dorsal raphe nucleus shows strong cytoplasmic positivity in serotonin neurons. |
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in serotonergic neural fibers. |
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules or glomeruli as expected. |
|
AMAb91108 |
|
AMAb91108 |
|
AMAb91108 |