Anti-TPH2, IgG1, Clone: [CL2990], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91108
- Images (9)
| Article Name: | Anti-TPH2, IgG1, Clone: [CL2990], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91108 |
| Supplier Catalog Number: | AMAb91108 |
| Alternative Catalog Number: | ATA-AMAB91108-100,ATA-AMAB91108-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ37295, NTPH |
| tryptophan hydroxylase 2 |
| Anti-TPH2 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2990] |
| Isotype: | IgG1 |
| NCBI: | 121278 |
| UniProt: | Q8IWU9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TPH2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescence staining of rat midbrain shows strong positivity in serotonin neurons in the dorsal raphe nucleus. |
|
|
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the basal forebrain. |
|
|
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the cerebral cortex. |
|
|
Immunohistochemical staining of human dorsal raphe nucleus shows strong cytoplasmic positivity in serotonin neurons. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in serotonergic neural fibers. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules or glomeruli as expected. |
|
|
AMAb91108 |
|
|
AMAb91108 |
|
|
AMAb91108 |
Product Guarantee and Expert Support
