Anti-TPH2 Antibody , IgG1, Clone: [CL2990], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-TPH2 Antibody , IgG1, Clone: [CL2990], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91108
• Supplier Catalog Number: AMAb91108
• Alternative Catalog Number: ATA-AMAB91108-100,ATA-AMAB91108-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ37295, NTPH

Product Description

tryptophan hydroxylase 2

Additional Information

Anti-TPH2

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL2990]
• Isotype: IgG1
• NCBI: 121278
• UniProt: Q8IWU9
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TPH2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500

Images

Immunofluorescence staining of rat midbrain shows strong positivity in serotonin neurons in the dorsal raphe nucleus.

Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the basal forebrain.

Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the cerebral cortex.

Immunohistochemical staining of human dorsal raphe nucleus shows strong cytoplasmic positivity in serotonin neurons.

Immunohistochemical staining of human cerebral cortex shows moderate positivity in serotonergic neural fibers.

Immunohistochemical staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.

AMAb91108

AMAb91108

AMAb91108