Anti-TPH2 Antibody , IgG1, Clone: [CL2990], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB91108
Article Name: Anti-TPH2 Antibody , IgG1, Clone: [CL2990], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB91108
Supplier Catalog Number: AMAb91108
Alternative Catalog Number: ATA-AMAB91108-100,ATA-AMAB91108-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ37295, NTPH
tryptophan hydroxylase 2
Anti-TPH2
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL2990]
Isotype: IgG1
NCBI: 121278
UniProt: Q8IWU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TPH2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunofluorescence staining of rat midbrain shows strong positivity in serotonin neurons in the dorsal raphe nucleus.
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the basal forebrain.
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the cerebral cortex.
Immunohistochemical staining of human dorsal raphe nucleus shows strong cytoplasmic positivity in serotonin neurons.
Immunohistochemical staining of human cerebral cortex shows moderate positivity in serotonergic neural fibers.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.
AMAb91108
AMAb91108
AMAb91108