Anti-LAMA1

Artikelnummer: ATA-AMAB91117
Artikelname: Anti-LAMA1
Artikelnummer: ATA-AMAB91117
Hersteller Artikelnummer: AMAb91117
Alternativnummer: ATA-AMAB91117-100,ATA-AMAB91117-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: LAMA
laminin, alpha 1
Anti-LAMA1
Klonalität: Monoclonal
Konzentration: 0.7
Klon-Bezeichnung: [CL3087]
Isotyp: IgG1
NCBI: 284217
UniProt: P25391
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LAMA1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemistry analysis in human testis and lymph node tissues using AMAb91117 antibody. Corresponding LAMA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows moderate positivity in basement membrane of cells in seminiferous ducts.
Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected.
Western blot analysis of purified human recombinant Laminin-111, Laminin-121, Laminin-221, Laminin-332, Laminin-411 and Laminin-521.
Western blot analysis in human testis tissue.
AMAb91117-100ul
AMAb91117-100ul
AMAb91117-100ul