Anti-LAMA1, IgG1, Clone: [CL3087], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91117
- Images (9)
| Article Name: | Anti-LAMA1, IgG1, Clone: [CL3087], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91117 |
| Supplier Catalog Number: | AMAb91117 |
| Alternative Catalog Number: | ATA-AMAB91117-100,ATA-AMAB91117-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LAMA |
| laminin, alpha 1 |
| Anti-LAMA1 |
| Clonality: | Monoclonal |
| Concentration: | 0.7 |
| Clone Designation: | [CL3087] |
| Isotype: | IgG1 |
| NCBI: | 284217 |
| UniProt: | P25391 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LAMA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human testis and lymph node tissues using AMAb91117 antibody. Corresponding LAMA1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate positivity in basement membrane of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected. |
|
|
Western blot analysis of purified human recombinant Laminin-111, Laminin-121, Laminin-221, Laminin-332, Laminin-411 and Laminin-521. |
|
|
Western blot analysis in human testis tissue. |
|
|
AMAb91117 |
|
|
|
|
|
AMAb91117 |
|
|
AMAb91117 |
Product Guarantee and Expert Support
