Anti-LAMA1 Antibody , IgG1, Clone: [CL3087], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB91117
Article Name: Anti-LAMA1 Antibody , IgG1, Clone: [CL3087], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB91117
Supplier Catalog Number: AMAb91117
Alternative Catalog Number: ATA-AMAB91117-100,ATA-AMAB91117-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LAMA
laminin, alpha 1
Anti-LAMA1
Clonality: Monoclonal
Concentration: 0.7
Clone Designation: [CL3087]
Isotype: IgG1
NCBI: 284217
UniProt: P25391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LAMA1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemistry analysis in human testis and lymph node tissues using AMAb91117 antibody. Corresponding LAMA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows moderate positivity in basement membrane of cells in seminiferous ducts.
Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected.
Western blot analysis of purified human recombinant Laminin-111, Laminin-121, Laminin-221, Laminin-332, Laminin-411 and Laminin-521.
Western blot analysis in human testis tissue.
AMAb91117
AMAb91117
AMAb91117