Anti-LAMA3 Antibody , IgG1, Clone: [CL3112], Unconjugated, Mouse, Monoclonal

Artikelnummer: ATA-AMAB91123
Artikelname: Anti-LAMA3 Antibody , IgG1, Clone: [CL3112], Unconjugated, Mouse, Monoclonal
Artikelnummer: ATA-AMAB91123
Hersteller Artikelnummer: AMAb91123
Alternativnummer: ATA-AMAB91123-100,ATA-AMAB91123-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
laminin, alpha 3
Anti-LAMA3
Klonalität: Monoclonal
Konzentration: 0.5
Klon-Bezeichnung: [CL3112]
Isotyp: IgG1
NCBI: 3909
UniProt: Q16787
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LAMA3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 1 µg/ml
Immunohistochemical staining of human stomach shows moderate immunoreactivity in basement membrane of glandular epithelium.
Immunohistochemical staining of human colon shows positivity in basement membrane of glandular epithelium.
Immunohistochemical staining of human oral mucosa shows moderate immunoreactivity in basement membrane of squamous epithelium.
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control).
Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
AMAb91123
AMAb91123
AMAb91123