Anti-LAMA3
Catalog Number:
ATA-AMAB91123
| Article Name: |
Anti-LAMA3 |
| Biozol Catalog Number: |
ATA-AMAB91123 |
| Supplier Catalog Number: |
AMAb91123 |
| Alternative Catalog Number: |
ATA-AMAB91123-100,ATA-AMAB91123-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Mouse |
| Category: |
Sonstiges |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa |
| Clonality: |
Monoclonal |
| Concentration: |
0.5 |
| Clone Designation: |
[CL3112] |
| Isotype: |
IgG1 |
| NCBI: |
3909 |
| UniProt: |
Q16787 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Protein A purified |
| Sequence: |
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
LAMA3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
Immunohistochemical staining of human stomach shows moderate immunoreactivity in basement membrane of glandular epithelium. |
|
Immunohistochemical staining of human colon shows positivity in basement membrane of glandular epithelium. |
|
Immunohistochemical staining of human oral mucosa shows moderate immunoreactivity in basement membrane of squamous epithelium. |
|
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control). |
|
Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221. |
|
AMAb91123-100ul |
|
|
|
AMAb91123-100ul |
|
AMAb91123-100ul |