Anti-LAMA3 Antibody , IgG1, Clone: [CL3112], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-LAMA3 Antibody , IgG1, Clone: [CL3112], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91123
• Supplier Catalog Number: AMAb91123
• Alternative Catalog Number: ATA-AMAB91123-100,ATA-AMAB91123-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa

Product Description

laminin, alpha 3

Additional Information

Anti-LAMA3

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5
• Clone Designation: [CL3112]
• Isotype: IgG1
• NCBI: 3909
• UniProt: Q16787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: LAMA3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 1 µg/ml

Images

Immunohistochemical staining of human stomach shows moderate immunoreactivity in basement membrane of glandular epithelium.

Immunohistochemical staining of human colon shows positivity in basement membrane of glandular epithelium.

Immunohistochemical staining of human oral mucosa shows moderate immunoreactivity in basement membrane of squamous epithelium.

Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control).

Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.

AMAb91123

AMAb91123

AMAb91123