Anti-LAMA3, IgG1, Clone: [CL3112], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91123
- Images (9)
| Article Name: | Anti-LAMA3, IgG1, Clone: [CL3112], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91123 |
| Supplier Catalog Number: | AMAb91123 |
| Alternative Catalog Number: | ATA-AMAB91123-100,ATA-AMAB91123-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa |
| laminin, alpha 3 |
| Anti-LAMA3 |
| Clonality: | Monoclonal |
| Concentration: | 0.5 |
| Clone Designation: | [CL3112] |
| Isotype: | IgG1 |
| NCBI: | 3909 |
| UniProt: | Q16787 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LAMA3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human stomach shows moderate immunoreactivity in basement membrane of glandular epithelium. |
|
|
Immunohistochemical staining of human colon shows positivity in basement membrane of glandular epithelium. |
|
|
Immunohistochemical staining of human oral mucosa shows moderate immunoreactivity in basement membrane of squamous epithelium. |
|
|
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control). |
|
|
Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221. |
|
|
AMAb91123 |
|
|
|
|
|
AMAb91123 |
|
|
AMAb91123 |
Product Guarantee and Expert Support
