Anti-PGM1
Artikelnummer:
ATA-AMAB91156
- Bilder (8)
| Artikelname: | Anti-PGM1 |
| Artikelnummer: | ATA-AMAB91156 |
| Hersteller Artikelnummer: | AMAb91156 |
| Alternativnummer: | ATA-AMAB91156-100,ATA-AMAB91156-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PGM1 |
| phosphoglucomutase 1 |
| Anti-PGM1 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.5 |
| Klon-Bezeichnung: | [CL3301] |
| Isotyp: | IgG1 |
| NCBI: | 5236 |
| UniProt: | P36871 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PGM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong immunoreactivity in hepatocytes. |
|
|
Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows absence of immunoreactivity as expected (negative control). |
|
|
Western blot analysis in human cell line RT-4. |
|
|
AMAb91156-100ul |
|
|
|
|
|
AMAb91156-100ul |
|
|
AMAb91156-100ul |
Produktgarantie und fachkundiger Support
