Anti-PGM1
Catalog Number:
ATA-AMAB91156
- Images (8)
| Article Name: | Anti-PGM1 |
| Biozol Catalog Number: | ATA-AMAB91156 |
| Supplier Catalog Number: | AMAb91156 |
| Alternative Catalog Number: | ATA-AMAB91156-100,ATA-AMAB91156-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PGM1 |
| phosphoglucomutase 1 |
| Anti-PGM1 |
| Clonality: | Monoclonal |
| Concentration: | 0.5 |
| Clone Designation: | [CL3301] |
| Isotype: | IgG1 |
| NCBI: | 5236 |
| UniProt: | P36871 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PGM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong immunoreactivity in hepatocytes. |
|
|
Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows absence of immunoreactivity as expected (negative control). |
|
|
Western blot analysis in human cell line RT-4. |
|
|
AMAb91156-100ul |
|
|
|
|
|
AMAb91156-100ul |
|
|
AMAb91156-100ul |
Product Guarantee and Expert Support
