Anti-DAXX
Artikelnummer:
ATA-AMAB91191
- Bilder (10)
| Artikelname: | Anti-DAXX |
| Artikelnummer: | ATA-AMAB91191 |
| Hersteller Artikelnummer: | AMAb91191 |
| Alternativnummer: | ATA-AMAB91191-100,ATA-AMAB91191-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DAP6 |
| death-domain associated protein |
| Anti-DAXX |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL3580] |
| Isotyp: | IgG1 |
| NCBI: | 1616 |
| UniProt: | Q9UER7 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DAXX |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cervix shows moderate nuclear immunoreactivity in epithelial and underlying connective tissue cells. |
|
|
Immunohistochemical staining of human breast shows nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows nuclear immunoreactivity in seminiferous tubules cells. |
|
|
Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows nuclear immunoreactivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity (negative control). |
|
|
AMAb91191-100ul |
|
|
|
|
|
AMAb91191-100ul |
|
|
AMAb91191-100ul |
Produktgarantie und fachkundiger Support
