Anti-DAXX
Catalog Number:
ATA-AMAB91191
- Images (10)
| Article Name: | Anti-DAXX |
| Biozol Catalog Number: | ATA-AMAB91191 |
| Supplier Catalog Number: | AMAb91191 |
| Alternative Catalog Number: | ATA-AMAB91191-100,ATA-AMAB91191-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DAP6 |
| death-domain associated protein |
| Anti-DAXX |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL3580] |
| Isotype: | IgG1 |
| NCBI: | 1616 |
| UniProt: | Q9UER7 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DAXX |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cervix shows moderate nuclear immunoreactivity in epithelial and underlying connective tissue cells. |
|
|
Immunohistochemical staining of human breast shows nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows nuclear immunoreactivity in seminiferous tubules cells. |
|
|
Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows nuclear immunoreactivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity (negative control). |
|
|
AMAb91191-100ul |
|
|
|
|
|
AMAb91191-100ul |
|
|
AMAb91191-100ul |
Product Guarantee and Expert Support
