Anti-VSIR
Artikelnummer:
ATA-AMAB91253
- Bilder (8)
| Artikelname: | Anti-VSIR |
| Artikelnummer: | ATA-AMAB91253 |
| Hersteller Artikelnummer: | AMAb91253 |
| Alternativnummer: | ATA-AMAB91253-100,ATA-AMAB91253-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA |
| V-set immunoregulatory receptor |
| Anti-VSIR |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL3981] |
| Isotyp: | IgG1 |
| NCBI: | 64115 |
| UniProt: | Q9H7M9 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | VSIR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2000 |
|
|
Immunohistochemical staining of human small intestine shows strong immunoreactivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows positivity in a subset of cells and blood vessels. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblast. |
|
|
Immunohistochemical staining of human liver shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human tonsil shows immunoreactivity in a subset of lymphoid and epithelial cells. |
|
|
AMAb91253-100ul |
|
|
AMAb91253-100ul |
|
|
AMAb91253-100ul |
Produktgarantie und fachkundiger Support
