Anti-VSIR
Catalog Number:
ATA-AMAB91253
- Images (8)
| Article Name: | Anti-VSIR |
| Biozol Catalog Number: | ATA-AMAB91253 |
| Supplier Catalog Number: | AMAb91253 |
| Alternative Catalog Number: | ATA-AMAB91253-100,ATA-AMAB91253-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA |
| V-set immunoregulatory receptor |
| Anti-VSIR |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL3981] |
| Isotype: | IgG1 |
| NCBI: | 64115 |
| UniProt: | Q9H7M9 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VSIR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2000 |
|
|
Immunohistochemical staining of human small intestine shows strong immunoreactivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows positivity in a subset of cells and blood vessels. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblast. |
|
|
Immunohistochemical staining of human liver shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human tonsil shows immunoreactivity in a subset of lymphoid and epithelial cells. |
|
|
AMAb91253-100ul |
|
|
AMAb91253-100ul |
|
|
AMAb91253-100ul |
Product Guarantee and Expert Support
