Anti-FOXJ1
Artikelnummer:
ATA-AMAB91254
- Bilder (7)
| Artikelname: | Anti-FOXJ1 |
| Artikelnummer: | ATA-AMAB91254 |
| Hersteller Artikelnummer: | AMAb91254 |
| Alternativnummer: | ATA-AMAB91254-100,ATA-AMAB91254-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FKHL13, HFH-4, HFH4 |
| forkhead box J1 |
| Anti-FOXJ1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL3989] |
| Isotyp: | IgG1 |
| NCBI: | 2302 |
| UniProt: | Q92949 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FOXJ1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2000 |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear immunoreactivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear positivity in some glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected (negative control). |
|
|
AMAb91254-100ul |
|
|
|
|
|
AMAb91254-100ul |
|
|
AMAb91254-100ul |
Produktgarantie und fachkundiger Support
