Anti-FOXJ1
Catalog Number:
ATA-AMAB91254
- Images (7)
| Article Name: | Anti-FOXJ1 |
| Biozol Catalog Number: | ATA-AMAB91254 |
| Supplier Catalog Number: | AMAb91254 |
| Alternative Catalog Number: | ATA-AMAB91254-100,ATA-AMAB91254-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FKHL13, HFH-4, HFH4 |
| forkhead box J1 |
| Anti-FOXJ1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL3989] |
| Isotype: | IgG1 |
| NCBI: | 2302 |
| UniProt: | Q92949 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FOXJ1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2000 |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear immunoreactivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear positivity in some glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected (negative control). |
|
|
AMAb91254-100ul |
|
|
|
|
|
AMAb91254-100ul |
|
|
AMAb91254-100ul |
Product Guarantee and Expert Support
