Anti-BRAF

Artikelnummer: ATA-AMAB91257
Artikelname: Anti-BRAF
Artikelnummer: ATA-AMAB91257
Hersteller Artikelnummer: AMAb91257
Alternativnummer: ATA-AMAB91257-100,ATA-AMAB91257-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BRAF1, RAFB1
B-Raf proto-oncogene, serine/threonine kinase
Anti-BRAF
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL4003]
Isotyp: IgG1
NCBI: 673
UniProt: P15056
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BRAF
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules.
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil and cytoplasmic staining in some neurons.
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular cells.
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells.
Western blot analysis in human cell line MOLT-4.
AMAb91257-100ul
AMAb91257-100ul
AMAb91257-100ul