Anti-BRAF
Artikelnummer:
ATA-AMAB91257
- Bilder (9)
| Artikelname: | Anti-BRAF |
| Artikelnummer: | ATA-AMAB91257 |
| Hersteller Artikelnummer: | AMAb91257 |
| Alternativnummer: | ATA-AMAB91257-100,ATA-AMAB91257-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BRAF1, RAFB1 |
| B-Raf proto-oncogene, serine/threonine kinase |
| Anti-BRAF |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL4003] |
| Isotyp: | IgG1 |
| NCBI: | 673 |
| UniProt: | P15056 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BRAF |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil and cytoplasmic staining in some neurons. |
|
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular cells. |
|
|
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
AMAb91257-100ul |
|
|
|
|
|
AMAb91257-100ul |
|
|
AMAb91257-100ul |
Produktgarantie und fachkundiger Support
