Anti-BRAF Antibody , IgG1, Clone: [CL4003], Unconjugated, Mouse, Monoclonal
Catalog Number:
ATA-AMAB91257
| Article Name: |
Anti-BRAF Antibody , IgG1, Clone: [CL4003], Unconjugated, Mouse, Monoclonal |
| Biozol Catalog Number: |
ATA-AMAB91257 |
| Supplier Catalog Number: |
AMAb91257 |
| Alternative Catalog Number: |
ATA-AMAB91257-100,ATA-AMAB91257-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Mouse |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
BRAF1, RAFB1 |
| B-Raf proto-oncogene, serine/threonine kinase |
| Clonality: |
Monoclonal |
| Concentration: |
1 |
| Clone Designation: |
[CL4003] |
| Isotype: |
IgG1 |
| NCBI: |
673 |
| UniProt: |
P15056 |
| Buffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Protein A purified |
| Sequence: |
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
BRAF |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules. |
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil and cytoplasmic staining in some neurons. |
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular cells. |
|
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells. |
|
Western blot analysis in human cell line MOLT-4. |
|
AMAb91257 |
|
|
|
AMAb91257 |
|
AMAb91257 |