Anti-BRAF, IgG1, Clone: [CL4003], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91257
- Images (9)
| Article Name: | Anti-BRAF, IgG1, Clone: [CL4003], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91257 |
| Supplier Catalog Number: | AMAb91257 |
| Alternative Catalog Number: | ATA-AMAB91257-100,ATA-AMAB91257-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BRAF1, RAFB1, Pan-Cancer |
| B-Raf proto-oncogene, serine/threonine kinase |
| Anti-BRAF |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL4003] |
| Isotype: | IgG1 |
| NCBI: | 673 |
| UniProt: | P15056 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BRAF |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil and cytoplasmic staining in some neurons. |
|
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular cells. |
|
|
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
AMAb91257 |
|
|
|
|
|
AMAb91257 |
|
|
AMAb91257 |
Product Guarantee and Expert Support
