Anti-BRAF Antibody , IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91258
| Artikelname: |
Anti-BRAF Antibody , IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal |
| Artikelnummer: |
ATA-AMAB91258 |
| Hersteller Artikelnummer: |
AMAb91258 |
| Alternativnummer: |
ATA-AMAB91258-100,ATA-AMAB91258-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
BRAF1, RAFB1 |
| B-Raf proto-oncogene, serine/threonine kinase |
| Klonalität: |
Monoclonal |
| Konzentration: |
1 |
| Klon-Bezeichnung: |
[CL4004] |
| Isotyp: |
IgG2b |
| NCBI: |
673 |
| UniProt: |
P15056 |
| Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Protein A purified |
| Sequenz: |
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
BRAF |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
Immunohistochemical staining of human prostate cancer shows moderate cytoplasmic immunoreactivity in tumor cells. |
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic immunoreactivity in tumor cells. |
|
Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous tubules. |
|
Western blot analysis in human cell line MOLT-4. |
|
AMAb91258 |
|
|
|
AMAb91258 |
|
AMAb91258 |