Anti-BRAF Antibody , IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-BRAF Antibody , IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91258
• Supplier Catalog Number: AMAb91258
• Alternative Catalog Number: ATA-AMAB91258-100,ATA-AMAB91258-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BRAF1, RAFB1

Product Description

B-Raf proto-oncogene, serine/threonine kinase

Additional Information

Anti-BRAF

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL4004]
• Isotype: IgG2b
• NCBI: 673
• UniProt: P15056
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: BRAF
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000, WB: 1 µg/ml

Images

Immunohistochemical staining of human prostate cancer shows moderate cytoplasmic immunoreactivity in tumor cells.

Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human breast cancer shows moderate cytoplasmic immunoreactivity in tumor cells.

Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous tubules.

Western blot analysis in human cell line MOLT-4.

AMAb91258

AMAb91258

AMAb91258