Anti-PRRT2
Artikelnummer:
ATA-AMAB91273
- Bilder (6)
| Artikelname: | Anti-PRRT2 |
| Artikelnummer: | ATA-AMAB91273 |
| Hersteller Artikelnummer: | AMAb91273 |
| Alternativnummer: | ATA-AMAB91273-100,ATA-AMAB91273-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp547J199, FICCA, FLJ25513, ICCA, IFITMD1 |
| proline-rich transmembrane protein 2 |
| Anti-PRRT2 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL4233] |
| Isotyp: | IgG1 |
| NCBI: | 112476 |
| UniProt: | Q7Z6L0 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | PKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRRT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows strong positivity in neuropil. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected (negative control). |
|
|
AMAb91273-100ul |
|
|
AMAb91273-100ul |
|
|
AMAb91273-100ul |
Produktgarantie und fachkundiger Support
