Anti-PRRT2
Catalog Number:
ATA-AMAB91273
- Images (6)
| Article Name: | Anti-PRRT2 |
| Biozol Catalog Number: | ATA-AMAB91273 |
| Supplier Catalog Number: | AMAb91273 |
| Alternative Catalog Number: | ATA-AMAB91273-100,ATA-AMAB91273-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp547J199, FICCA, FLJ25513, ICCA, IFITMD1 |
| proline-rich transmembrane protein 2 |
| Anti-PRRT2 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL4233] |
| Isotype: | IgG1 |
| NCBI: | 112476 |
| UniProt: | Q7Z6L0 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | PKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRRT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows strong positivity in neuropil. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected (negative control). |
|
|
AMAb91273-100ul |
|
|
AMAb91273-100ul |
|
|
AMAb91273-100ul |
Product Guarantee and Expert Support
