Anti-SMCHD1
Artikelnummer:
ATA-AMAB91282
- Bilder (9)
| Artikelname: | Anti-SMCHD1 |
| Artikelnummer: | ATA-AMAB91282 |
| Hersteller Artikelnummer: | AMAb91282 |
| Alternativnummer: | ATA-AMAB91282-100,ATA-AMAB91282-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0650 |
| structural maintenance of chromosomes flexible hinge domain containing 1 |
| Anti-SMCHD1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL4270] |
| Isotyp: | IgG2b |
| NCBI: | 23347 |
| UniProt: | A6NHR9 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SMCHD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in glandular cells and in connective tissue cells. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear immunoreactivity in trophoblast. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in seminiferous tubules cells. |
|
|
Immunohistochemical staining of human lymph node shows weak to moderate nuclear immunoreactivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity as expected (negative control). |
|
|
|
|
|
AMAb91282 |
|
|
AMAb91282 |
|
|
AMAb91282 |
Produktgarantie und fachkundiger Support
