Anti-SMCHD1

Artikelnummer: ATA-AMAB91282
Artikelname: Anti-SMCHD1
Artikelnummer: ATA-AMAB91282
Hersteller Artikelnummer: AMAb91282
Alternativnummer: ATA-AMAB91282-100,ATA-AMAB91282-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0650
structural maintenance of chromosomes flexible hinge domain containing 1
Anti-SMCHD1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL4270]
Isotyp: IgG2b
NCBI: 23347
UniProt: A6NHR9
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SMCHD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200
Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in glandular cells and in connective tissue cells.
Immunohistochemical staining of human placenta shows strong nuclear immunoreactivity in trophoblast.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in seminiferous tubules cells.
Immunohistochemical staining of human lymph node shows weak to moderate nuclear immunoreactivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no positivity as expected (negative control).
AMAb91282-100ul
AMAb91282-100ul
AMAb91282-100ul