Anti-SMCHD1

Catalog Number: ATA-AMAB91282
Article Name: Anti-SMCHD1
Biozol Catalog Number: ATA-AMAB91282
Supplier Catalog Number: AMAb91282
Alternative Catalog Number: ATA-AMAB91282-100,ATA-AMAB91282-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0650
structural maintenance of chromosomes flexible hinge domain containing 1
Anti-SMCHD1
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL4270]
Isotype: IgG2b
NCBI: 23347
UniProt: A6NHR9
Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SMCHD1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200
Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in glandular cells and in connective tissue cells.
Immunohistochemical staining of human placenta shows strong nuclear immunoreactivity in trophoblast.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in seminiferous tubules cells.
Immunohistochemical staining of human lymph node shows weak to moderate nuclear immunoreactivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no positivity as expected (negative control).
AMAb91282-100ul
AMAb91282-100ul
AMAb91282-100ul