Anti-SMCHD1
Catalog Number:
ATA-AMAB91282
- Images (9)
| Article Name: | Anti-SMCHD1 |
| Biozol Catalog Number: | ATA-AMAB91282 |
| Supplier Catalog Number: | AMAb91282 |
| Alternative Catalog Number: | ATA-AMAB91282-100,ATA-AMAB91282-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0650 |
| structural maintenance of chromosomes flexible hinge domain containing 1 |
| Anti-SMCHD1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL4270] |
| Isotype: | IgG2b |
| NCBI: | 23347 |
| UniProt: | A6NHR9 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMCHD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200 |









