Anti-MKL1
Artikelnummer:
ATA-AMAB91285
- Bilder (7)
| Artikelname: | Anti-MKL1 |
| Artikelnummer: | ATA-AMAB91285 |
| Hersteller Artikelnummer: | AMAb91285 |
| Alternativnummer: | ATA-AMAB91285-100,ATA-AMAB91285-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BSAC, KIAA1438, MAL, MRTF-A |
| megakaryoblastic leukemia (translocation) 1 |
| Anti-MKL1 |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [CL4281] |
| Isotyp: | IgG1 |
| NCBI: | 57591 |
| UniProt: | Q969V6 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MKL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows moderate immunoreactivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous tubules |
|
|
Western blot analysis in human cell line HL-60. |
|
|
AMAb91285-100ul |
|
|
|
|
|
AMAb91285-100ul |
|
|
AMAb91285-100ul |
Produktgarantie und fachkundiger Support
