Anti-MKL1
Catalog Number:
ATA-AMAB91285
- Images (7)
| Article Name: | Anti-MKL1 |
| Biozol Catalog Number: | ATA-AMAB91285 |
| Supplier Catalog Number: | AMAb91285 |
| Alternative Catalog Number: | ATA-AMAB91285-100,ATA-AMAB91285-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BSAC, KIAA1438, MAL, MRTF-A |
| megakaryoblastic leukemia (translocation) 1 |
| Anti-MKL1 |
| Clonality: | Monoclonal |
| Clone Designation: | [CL4281] |
| Isotype: | IgG1 |
| NCBI: | 57591 |
| UniProt: | Q969V6 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MKL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows moderate immunoreactivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous tubules |
|
|
Western blot analysis in human cell line HL-60. |
|
|
AMAb91285-100ul |
|
|
|
|
|
AMAb91285-100ul |
|
|
AMAb91285-100ul |
Product Guarantee and Expert Support
