Anti-USP30
Artikelnummer:
ATA-AMAB91295
- Bilder (7)
| Artikelname: | Anti-USP30 |
| Artikelnummer: | ATA-AMAB91295 |
| Hersteller Artikelnummer: | AMAb91295 |
| Alternativnummer: | ATA-AMAB91295-100,ATA-AMAB91295-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ40511, MGC10702 |
| ubiquitin specific peptidase 30 |
| Anti-USP30 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL4438] |
| Isotyp: | IgG2a |
| NCBI: | 84749 |
| UniProt: | Q70CQ3 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | USP30 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells. |
|
|
AMAb91295-100ul |
|
|
AMAb91295-100ul |
|
|
AMAb91295-100ul |
Produktgarantie und fachkundiger Support
