Anti-USP30
Catalog Number:
ATA-AMAB91295
- Images (7)
| Article Name: | Anti-USP30 |
| Biozol Catalog Number: | ATA-AMAB91295 |
| Supplier Catalog Number: | AMAb91295 |
| Alternative Catalog Number: | ATA-AMAB91295-100,ATA-AMAB91295-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ40511, MGC10702 |
| ubiquitin specific peptidase 30 |
| Anti-USP30 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL4438] |
| Isotype: | IgG2a |
| NCBI: | 84749 |
| UniProt: | Q70CQ3 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | USP30 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells. |
|
|
AMAb91295-100ul |
|
|
AMAb91295-100ul |
|
|
AMAb91295-100ul |
Product Guarantee and Expert Support
