Anti-CT83
Artikelnummer:
ATA-AMAB91318
- Bilder (8)
| Artikelname: | Anti-CT83 |
| Artikelnummer: | ATA-AMAB91318 |
| Hersteller Artikelnummer: | AMAb91318 |
| Alternativnummer: | ATA-AMAB91318-100,ATA-AMAB91318-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CXorf61, FLJ20611, FLJ22913, KK-LC-1 |
| cancer/testis antigen 83 |
| Anti-CT83 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL4762] |
| Isotyp: | IgG1 |
| NCBI: | 203413 |
| UniProt: | Q5H943 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CT83 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human testis and cervix, uterine tissues using AMAb91318 antibody. Corresponding CT83 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human uterine cervix shows no positivity in squamous epithelial cells as expected. |
|
|
Western blot analysis in human cell line HeLa. |
|
|
AMAb91318-100ul |
|
|
|
|
|
AMAb91318-100ul |
|
|
AMAb91318-100ul |
Produktgarantie und fachkundiger Support
