Anti-CT83
Catalog Number:
ATA-AMAB91318
- Images (8)
| Article Name: | Anti-CT83 |
| Biozol Catalog Number: | ATA-AMAB91318 |
| Supplier Catalog Number: | AMAb91318 |
| Alternative Catalog Number: | ATA-AMAB91318-100,ATA-AMAB91318-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CXorf61, FLJ20611, FLJ22913, KK-LC-1 |
| cancer/testis antigen 83 |
| Anti-CT83 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL4762] |
| Isotype: | IgG1 |
| NCBI: | 203413 |
| UniProt: | Q5H943 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CT83 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human testis and cervix, uterine tissues using AMAb91318 antibody. Corresponding CT83 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human uterine cervix shows no positivity in squamous epithelial cells as expected. |
|
|
Western blot analysis in human cell line HeLa. |
|
|
AMAb91318-100ul |
|
|
|
|
|
AMAb91318-100ul |
|
|
AMAb91318-100ul |
Product Guarantee and Expert Support
