Anti-CLIP1

Artikelnummer: ATA-AMAB91319
Artikelname: Anti-CLIP1
Artikelnummer: ATA-AMAB91319
Hersteller Artikelnummer: AMAb91319
Alternativnummer: ATA-AMAB91319-100,ATA-AMAB91319-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLIP, CLIP-170, CLIP170, CYLN1, RSN
CAP-GLY domain containing linker protein 1
Anti-CLIP1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL4844]
Isotyp: IgG1
NCBI: 6249
UniProt: P30622
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CLIP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblast.
Immunohistochemical staining of human cervix shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human kidney shows moderate cytoplasmic immunoreactivity in a subset of renal tubules.
Immunohistochemical staining of human prostate shows weak cytoplasmic positivity in glandular and smooth muscle cells.
Western blot analysis in human cell line SiHa.
AMAb91319-100ul
AMAb91319-100ul
AMAb91319-100ul