Anti-CLIP1
Catalog Number:
ATA-AMAB91319
- Images (9)
| Article Name: | Anti-CLIP1 |
| Biozol Catalog Number: | ATA-AMAB91319 |
| Supplier Catalog Number: | AMAb91319 |
| Alternative Catalog Number: | ATA-AMAB91319-100,ATA-AMAB91319-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CLIP, CLIP-170, CLIP170, CYLN1, RSN |
| CAP-GLY domain containing linker protein 1 |
| Anti-CLIP1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL4844] |
| Isotype: | IgG1 |
| NCBI: | 6249 |
| UniProt: | P30622 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CLIP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblast. |
|
|
Immunohistochemical staining of human cervix shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic immunoreactivity in a subset of renal tubules. |
|
|
Immunohistochemical staining of human prostate shows weak cytoplasmic positivity in glandular and smooth muscle cells. |
|
|
Western blot analysis in human cell line SiHa. |
|
|
AMAb91319-100ul |
|
|
|
|
|
AMAb91319-100ul |
|
|
AMAb91319-100ul |
Product Guarantee and Expert Support
