Anti-PRAME

Artikelnummer: ATA-AMAB91330
Artikelname: Anti-PRAME
Artikelnummer: ATA-AMAB91330
Hersteller Artikelnummer: AMAb91330
Alternativnummer: ATA-AMAB91330-100,ATA-AMAB91330-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CT130, MAPE
preferentially expressed antigen in melanoma
Anti-PRAME
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL5148]
Isotyp: IgG1
NCBI: 23532
UniProt: P78395
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRAME
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:250 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human testis shows moderate to strong nuclear immunoreactivity in a subset of cells in seminiferous tubules.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human cervix shows absence of positivity as expected (negative control).
Western blot analysis in human cell line U-2 OS.
AMAb91330-100ul
AMAb91330-100ul
AMAb91330-100ul