Anti-PRAME

Catalog Number: ATA-AMAB91330
Article Name: Anti-PRAME
Biozol Catalog Number: ATA-AMAB91330
Supplier Catalog Number: AMAb91330
Alternative Catalog Number: ATA-AMAB91330-100,ATA-AMAB91330-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT130, MAPE
preferentially expressed antigen in melanoma
Anti-PRAME
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL5148]
Isotype: IgG1
NCBI: 23532
UniProt: P78395
Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PRAME
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:250 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human testis shows moderate to strong nuclear immunoreactivity in a subset of cells in seminiferous tubules.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human cervix shows absence of positivity as expected (negative control).
Western blot analysis in human cell line U-2 OS.
AMAb91330-100ul
AMAb91330-100ul
AMAb91330-100ul