Anti-CUX1
Artikelnummer:
ATA-AMAB91352
- Bilder (9)
| Artikelname: | Anti-CUX1 |
| Artikelnummer: | ATA-AMAB91352 |
| Hersteller Artikelnummer: | AMAb91352 |
| Alternativnummer: | ATA-AMAB91352-100,ATA-AMAB91352-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CUTL1 |
| cut-like homeobox 1 |
| Anti-CUX1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL5275] |
| Isotyp: | IgG2b |
| NCBI: | 1523 |
| UniProt: | P39880 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CUX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:1000-1:2500 |









