Anti-CUX1

Artikelnummer: ATA-AMAB91352
Artikelname: Anti-CUX1
Artikelnummer: ATA-AMAB91352
Hersteller Artikelnummer: AMAb91352
Alternativnummer: ATA-AMAB91352-100,ATA-AMAB91352-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CUTL1
cut-like homeobox 1
Anti-CUX1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL5275]
Isotyp: IgG2b
NCBI: 1523
UniProt: P39880
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CUX1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:1000-1:2500
Immunofluorescence staining of WM-115 cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunofluorescence staining of SH-SY5Y cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemical staining of human cerebellum shows moderate nuclear immunoreactivity in neuronal cells in granular, molecular and Purkinje cells layers.
Immunohistochemical staining of human endometrium shows nuclear immunoreactivity in glandular and stromal cells.
Immunohistochemical staining of human cervix shows strong nuclear positivity in epithelial cells.
AMAb91352-100ul
AMAb91352-100ul
AMAb91352-100ul