Anti-CUX1

Product Overview

• Article Name: Anti-CUX1
• Biozol Catalog Number: ATA-AMAB91352
• Supplier Catalog Number: AMAb91352
• Alternative Catalog Number: ATA-AMAB91352-100,ATA-AMAB91352-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Sonstiges
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CUTL1

Product Description

cut-like homeobox 1

Additional Information

Anti-CUX1

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL5275]
• Isotype: IgG2b
• NCBI: 1523
• UniProt: P39880
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CUX1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:1000-1:2500

Images

Immunofluorescence staining of WM-115 cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Immunofluorescence staining of SH-SY5Y cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Immunohistochemical staining of human cerebellum shows moderate nuclear immunoreactivity in neuronal cells in granular, molecular and Purkinje cells layers.

Immunohistochemical staining of human endometrium shows nuclear immunoreactivity in glandular and stromal cells.

Immunohistochemical staining of human cervix shows strong nuclear positivity in epithelial cells.

AMAb91352

AMAb91352

AMAb91352