Anti-CUX1

Catalog Number: ATA-AMAB91352
Article Name: Anti-CUX1
Biozol Catalog Number: ATA-AMAB91352
Supplier Catalog Number: AMAb91352
Alternative Catalog Number: ATA-AMAB91352-100,ATA-AMAB91352-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CUTL1
cut-like homeobox 1
Anti-CUX1
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL5275]
Isotype: IgG2b
NCBI: 1523
UniProt: P39880
Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CUX1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:1000-1:2500
Immunofluorescence staining of WM-115 cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunofluorescence staining of SH-SY5Y cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemical staining of human cerebellum shows moderate nuclear immunoreactivity in neuronal cells in granular, molecular and Purkinje cells layers.
Immunohistochemical staining of human endometrium shows nuclear immunoreactivity in glandular and stromal cells.
Immunohistochemical staining of human cervix shows strong nuclear positivity in epithelial cells.
AMAb91352-100ul
AMAb91352-100ul
AMAb91352-100ul