Anti-PAX6
Artikelnummer:
ATA-AMAB91372
- Bilder (8)
| Artikelname: | Anti-PAX6 |
| Artikelnummer: | ATA-AMAB91372 |
| Hersteller Artikelnummer: | AMAb91372 |
| Alternativnummer: | ATA-AMAB91372-100,ATA-AMAB91372-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AN, AN2, D11S812E, WAGR |
| paired box 6 |
| Anti-PAX6 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL5414] |
| Isotyp: | IgG1 |
| NCBI: | 5080 |
| UniProt: | P26367 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PAX6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescence staining of HEK 293 cells using the Anti-PAX6 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). |
|
|
Immunohistochemical staining of rat eye retina shows strong nuclear immunoreactivity in the inner nuclear layer and ganglion cell layer. |
|
|
Immunohistochemical staining of mouse embryo E11 shows strong nuclear immunoreactivity in the developing brain and sensory organs. |
|
|
Immunohistochemical staining of mouse embryo E14 shows strong nuclear immunoreactivity in the developing eye. |
|
|
AMAb91372-100ul |
|
|
|
|
|
AMAb91372-100ul |
|
|
AMAb91372-100ul |
Produktgarantie und fachkundiger Support
