Anti-PAX6
Catalog Number:
ATA-AMAB91372
- Images (8)
| Article Name: | Anti-PAX6 |
| Biozol Catalog Number: | ATA-AMAB91372 |
| Supplier Catalog Number: | AMAb91372 |
| Alternative Catalog Number: | ATA-AMAB91372-100,ATA-AMAB91372-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AN, AN2, D11S812E, WAGR |
| paired box 6 |
| Anti-PAX6 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL5414] |
| Isotype: | IgG1 |
| NCBI: | 5080 |
| UniProt: | P26367 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PAX6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescence staining of HEK 293 cells using the Anti-PAX6 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). |
|
|
Immunohistochemical staining of rat eye retina shows strong nuclear immunoreactivity in the inner nuclear layer and ganglion cell layer. |
|
|
Immunohistochemical staining of mouse embryo E11 shows strong nuclear immunoreactivity in the developing brain and sensory organs. |
|
|
Immunohistochemical staining of mouse embryo E14 shows strong nuclear immunoreactivity in the developing eye. |
|
|
AMAb91372-100ul |
|
|
|
|
|
AMAb91372-100ul |
|
|
AMAb91372-100ul |
Product Guarantee and Expert Support
