Anti-CPA1

Artikelnummer: ATA-AMAB91433
Artikelname: Anti-CPA1
Artikelnummer: ATA-AMAB91433
Hersteller Artikelnummer: AMAb91433
Alternativnummer: ATA-AMAB91433-100,ATA-AMAB91433-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CPA
carboxypeptidase A1
Anti-CPA1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL6607]
Isotyp: IgG2b
NCBI: 1357
UniProt: P15085
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CPA1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunohistochemistry analysis in human pancreas and tonsil tissues using AMAb91433 antibody. Corresponding CPA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
Western blot analysis in human pancreas tissue.
AMAb91433-100ul
AMAb91433-100ul
AMAb91433-100ul