Anti-CPA1
Catalog Number:
ATA-AMAB91433
- Images (8)
| Article Name: | Anti-CPA1 |
| Biozol Catalog Number: | ATA-AMAB91433 |
| Supplier Catalog Number: | AMAb91433 |
| Alternative Catalog Number: | ATA-AMAB91433-100,ATA-AMAB91433-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CPA |
| carboxypeptidase A1 |
| Anti-CPA1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL6607] |
| Isotype: | IgG2b |
| NCBI: | 1357 |
| UniProt: | P15085 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CPA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human pancreas and tonsil tissues using AMAb91433 antibody. Corresponding CPA1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Western blot analysis in human pancreas tissue. |
|
|
AMAb91433-100ul |
|
|
|
|
|
AMAb91433-100ul |
|
|
AMAb91433-100ul |
Product Guarantee and Expert Support
