Anti-ITGA5
Artikelnummer:
ATA-AMAB91448
- Bilder (8)
| Artikelname: | Anti-ITGA5 |
| Artikelnummer: | ATA-AMAB91448 |
| Hersteller Artikelnummer: | AMAb91448 |
| Alternativnummer: | ATA-AMAB91448-100,ATA-AMAB91448-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD49e, FNRA |
| integrin subunit alpha 5 |
| Anti-ITGA5 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL6945] |
| Isotyp: | IgG1 |
| NCBI: | 3678 |
| UniProt: | P08648 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ITGA5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human placenta and testis tissues using AMAb91448 antibody. Corresponding ITGA5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows strong apical membrane positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human liver shows moderate positivity in liver sinusoids. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
AMAb91448-100ul |
|
|
AMAb91448-100ul |
|
|
AMAb91448-100ul |
Produktgarantie und fachkundiger Support
