Anti-ITGA5
Catalog Number:
ATA-AMAB91448
- Images (8)
| Article Name: | Anti-ITGA5 |
| Biozol Catalog Number: | ATA-AMAB91448 |
| Supplier Catalog Number: | AMAb91448 |
| Alternative Catalog Number: | ATA-AMAB91448-100,ATA-AMAB91448-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD49e, FNRA |
| integrin subunit alpha 5 |
| Anti-ITGA5 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL6945] |
| Isotype: | IgG1 |
| NCBI: | 3678 |
| UniProt: | P08648 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ITGA5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |








