Anti-ITGA5

Catalog Number: ATA-AMAB91448
Article Name: Anti-ITGA5
Biozol Catalog Number: ATA-AMAB91448
Supplier Catalog Number: AMAb91448
Alternative Catalog Number: ATA-AMAB91448-100,ATA-AMAB91448-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD49e, FNRA
integrin subunit alpha 5
Anti-ITGA5
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL6945]
Isotype: IgG1
NCBI: 3678
UniProt: P08648
Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ITGA5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human placenta and testis tissues using AMAb91448 antibody. Corresponding ITGA5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows strong apical membrane positivity in trophoblastic cells.
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in smooth muscle cells.
Immunohistochemical staining of human liver shows moderate positivity in liver sinusoids.
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
AMAb91448-100ul
AMAb91448-100ul
AMAb91448-100ul