Anti-KHDRBS3
Artikelnummer:
ATA-HPA000275
- Bilder (8)
| Artikelname: | Anti-KHDRBS3 |
| Artikelnummer: | ATA-HPA000275 |
| Hersteller Artikelnummer: | HPA000275 |
| Alternativnummer: | ATA-HPA000275-100,ATA-HPA000275-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Etle, etoile, SALP, SLM-2, SLM2, T-STAR |
| KH domain containing, RNA binding, signal transduction associated 3 |
| Anti-KHDRBS3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10656 |
| UniProt: | O75525 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KHDRBS3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and placenta tissues using HPA000275 antibody. Corresponding KHDRBS3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
HPA000275-100ul |
|
|
HPA000275-100ul |
|
|
HPA000275-100ul |
Produktgarantie und fachkundiger Support
