Anti-KHDRBS3
Catalog Number:
ATA-HPA000275
- Images (8)
| Article Name: | Anti-KHDRBS3 |
| Biozol Catalog Number: | ATA-HPA000275 |
| Supplier Catalog Number: | HPA000275 |
| Alternative Catalog Number: | ATA-HPA000275-100,ATA-HPA000275-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Etle, etoile, SALP, SLM-2, SLM2, T-STAR |
| KH domain containing, RNA binding, signal transduction associated 3 |
| Anti-KHDRBS3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10656 |
| UniProt: | O75525 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KHDRBS3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and placenta tissues using HPA000275 antibody. Corresponding KHDRBS3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
HPA000275-100ul |
|
|
HPA000275-100ul |
|
|
HPA000275-100ul |
Product Guarantee and Expert Support
